All Primary Antibodies
All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (2)
- (31)
- (2)
- (1)
- (1,107)
- (8)
- (8)
- (8)
- (306)
- (26)
- (14)
- (1)
- (4)
- (19)
- (21)
- (192)
- (29)
- (1)
- (198)
- (514)
- (32)
- (1)
- (687)
- (256)
- (2)
- (2)
- (3)
- (4)
- (3)
- (4)
- (5)
- (4)
- (3)
- (6)
- (5)
- (5)
- (1)
- (990)
- (39)
- (3)
- (46)
- (46)
- (46)
- (45)
- (46)
- (45)
- (46)
- (46)
- (66)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (46)
- (46)
- (46)
- (46)
- (46)
- (43)
- (46)
- (45)
- (45)
- (49)
- (1)
- (55)
- (44)
- (40)
- (44)
- (43)
- (40)
- (42)
- (40)
- (3)
- (3)
- (3)
- (39)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (572)
- (40)
- (40)
- (40)
- (2)
- (61)
- (12)
- (540)
- (1,414)
- (8)
- (8)
- (3)
- (4)
- (2)
- (1,391)
- (15)
- (5)
- (3)
- (6)
- (189)
- (188)
- (5)
- (26)
- (15)
- (4)
- (9)
- (3)
- (6)
- (6)
- (26)
- (34)
- (3)
- (12)
- (9)
- (70)
- (2)
- (5)
- (3)
- (1)
- (14)
- (25)
- (181)
- (5)
- (1,602)
- (602)
- (11)
- (2)
- (34)
- (9)
- (7)
- (143)
- (11)
- (1)
- (1)
- (1)
Filtered Search Results
Carbonic Anhydrase VI Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VI |
Gene Symbols | CA6 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Gene Alias | Carbonate dehydratase VI, carbonic anhydrase 6, carbonic anhydrase VIGUSTIN, CA-VI, EC 4.2.1.1, MGC21256, Salivary carbonic anhydrase, Secreted carbonic anhydrase |
Gene ID (Entrez) | 765 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | -20°C or -80°C if preferred |
---|---|
Target Species | Human,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P00915, P13634 |
Antigen | Carbonic Anhydrase I |
Gene Symbols | CA1, Car1 |
Regulatory Status | RUO |
Gene Alias | AW555628, CA I, CA1, ca1 {ECO:0000250, CAB, CA-I, CA-I {ECO:0000250, Car1, Car-1, Carbonate dehydratase I, carbonate dehydratase I {ECO:0000250, carbonic anhydrase 1, carbonic anhydrase 1 {ECO:0000250, Carbonic anhydrase B, carbonic anhydrase I, carbonic anhydrase I {ECO:0000250, epididymis secretory protein Li 11, HEL-S-11, UniProtKB:P00915} |
Gene | CA1 |
Product Type | Antibody |
Gene ID (Entrez) | 12346, 759 |
Classification | Polyclonal |
Primary or Secondary | Primary |
Carbonic Anhydrase IV Polyclonal Antibody, Invitrogen™
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Porcine,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P22748, P48284, Q64444 |
Concentration | 0.5 mg/mL |
Antigen | Carbonic Anhydrase IV |
Gene Symbols | CA4, Car4 |
Regulatory Status | RUO |
Purification Method | Affinity chromatography |
Gene Alias | AW456718, CA IV, CA4, CAIV, CA-IV, Car4, Carbonate dehydratase IV, carbonic anhydrase 4, Carbonic anhydrase IV, carbonic dehydratase IV, RP17 |
Gene | CA4 |
Gene ID (Entrez) | 100511956, 12351, 29242, 762 |
Formulation | PBS with 50% glycerol and 0.05% Proclin 300, pH 7.4 |
Immunogen | Recombinant Rat CA4 protein, Ser20-Ser220 (Accession #P48284) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Carbonic Anhydrase VI Polyclonal Antibody, Invitrogen™
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot |
Form | Liquid |
Isotype | IgG |
Concentration | 0.5 mg/mL |
Antigen | Carbonic Anhydrase VI |
Gene Symbols | Car6 |
Regulatory Status | RUO |
Purification Method | Protein A |
Gene Alias | CA6, CA-6, Car6, Carbonate dehydratase VI, carbonic anhydrase 6, Carbonic anhydrase VI, carbonic anhydrase VI nirs variant 2, Carbonic anhydrase6, CA-VI, DOC1, GUSTIN, salivary carbonic anhydrase, Secreted carbonic anhydrase |
Gene | Car6 |
Gene ID (Entrez) | 298657 |
Formulation | PBS with 50% glycerol and 0.05% Proclin 300, pH 7.4 |
Immunogen | Recombinant Rat CA6 protein, Thr147-Ala275 (Accession #F1LQ08) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Carbonic Anhydrase VA Polyclonal Antibody, Invitrogen™
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P23589, P43165 |
Concentration | 0.5 mg/mL |
Antigen | Carbonic Anhydrase VA |
Gene Symbols | CA5A, Car5a |
Regulatory Status | RUO |
Purification Method | Protein A |
Gene Alias | CA Y, CA5, CA5A, CA5AD, Car5, Car5a, Carbonate dehydratase VA, carbonic anhydrase 5 mitochondrial, carbonic anhydrase 5, mitochondrial, carbonic anhydrase 5A, carbonic anhydrase 5a, mitochondrial, carbonic anhydrase 5b, mitochondrial, carbonic anhydrase V, mitochondrial, carbonic anhydrase VA, carbonic anhydrase VA, mitochondrial, carbonic dehydratase, CAV, CAVA, CA-VA, GS1-21A4.1 |
Gene | Car5a |
Gene ID (Entrez) | 12352, 54233 |
Formulation | PBS with 50% glycerol and 0.05% Proclin 300, pH 7.4 |
Immunogen | Recombinant Rat CA5A protein, Tyr12-Leu219 (Accession #P43165) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Carbonic Anhydrase III Monoclonal Antibody (5G8B6), Invitrogen™
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA |
Form | Liquid |
Isotype | IgG1 |
Gene Accession No. | P07451 |
Concentration | 1 mg/mL |
Antigen | Carbonic Anhydrase III |
Gene Symbols | Ca3 |
Regulatory Status | RUO |
Purification Method | Protein A |
Gene Alias | BB219044; CA III; Ca3; CAH3; CAIII; CA-III; CAIII (Muscle); Car3; Car-3; Carbonate dehydratase III; carbonic anhydrase 3; Carbonic anhydrase III; carbonic anhydrase III, muscle specific; carbonic anhydrase-like protein; EC 4.2.1.1; epididymis secretory sperm binding protein Li 167mP; HEL-S-167mP |
Gene | Ca3 |
Product Type | Antibody |
Gene ID (Entrez) | 761 |
Formulation | PBS with no preservative |
Immunogen | Recombinant Human Carbonic Anhydrase III/CA3 Protein. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 5G8B6 |
Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | Q86YU0 |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VII/CA7 |
Gene Symbols | CA7 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 23 kDa |
Gene Alias | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
Gene ID (Entrez) | 766 |
Immunogen | Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Carbonic Anhydrase XIV/CA14 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XIV/CA14 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:1000, ELISA 1:5000-1:10000 |
Gene Alias | Carbonate dehydratase XIV, carbonic anhydrase XIVcarbonic anhydrase 14, carbonic dehydratase, CAXiV, CA-XIV, EC 4.2.1.1 |
Gene ID (Entrez) | 23632 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase XIV/CA14 (Accession#: NP_035927.1; Met 1-Met 290) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Carbonic Anhydrase XIV/CA14 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XIV/CA14 |
Gene Symbols | CA14 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
Gene Alias | Carbonate dehydratase XIV, carbonic anhydrase XIVcarbonic anhydrase 14, carbonic dehydratase, CAXiV, CA-XIV, EC 4.2.1.1 |
Gene ID (Entrez) | 23632 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGIL |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Gene Accession No. | P35219 |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Gene Symbols | CA8 |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Molecular Weight of Antigen | 32 kDa |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Immunogen | Synthetic peptides corresponding to CA8(carbonic anhydrase VIII) The peptide sequence was selected from the N terminal of CA8. Peptide sequence YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Carbonic Anhydrase III Monoclonal Antibody (C2), Invitrogen™
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Porcine,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot |
Form | Liquid |
Isotype | IgG2b κ |
Gene Accession No. | P07451, P14141, P16015, Q5S1S4 |
Concentration | 1 mg/mL |
Antigen | Carbonic Anhydrase III |
Gene Symbols | Ca3, Car3 |
Regulatory Status | RUO |
Purification Method | Protein A/G |
Gene Alias | BB219044, CA III, Ca3, CAH3, CAIII, CA-III, CAIII (Muscle), Car3, Car-3, Carbonate dehydratase III, carbonic anhydrase 3, Carbonic anhydrase III, carbonic anhydrase III, muscle specific, carbonic anhydrase-like protein, EC 4.2.1.1, epididymis secretory sperm binding protein Li 167mP, HEL-S-167mP |
Gene | Ca3 |
Gene ID (Entrez) | 12350, 494016, 54232, 761 |
Formulation | PBS with 50% glycerol and 0.05% Proclin 300, pH 7.4 |
Immunogen | Recombinant Human CA3 protein, Ala2-Lys260 (Accession #P07451) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | C2 |
Carbonic Anhydrase XII/CA12 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XII/CA12 |
Gene Symbols | CA12 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | Carbonate dehydratase XII, carbonic anhydrase 12, carbonic anhydrase XIICAXII, carbonic dehydratase, CA-XII, EC 4.2.1.1, FLJ20151, HsT18816, Tumor antigen HOM-RCC-3.1.3 |
Gene ID (Entrez) | 771 |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAEL |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VII/CA7 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | ELISA 1:5000-1:10000 |
Gene Alias | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
Gene ID (Entrez) | 766 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VII/CA7 (Accession#: P43166; Met1-Ala264) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Carbonic Anhydrase X/CA10 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Antigen | Carbonic Anhydrase X/CA10 |
Gene Symbols | CA10 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
Gene ID (Entrez) | 56934 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Gene Symbols | CA8 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |