Antibodies
Antibodies
Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
1,266
results
Novus Biologicals™ Potassium Channel Kv3.1 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Neuronal Cell Markers, Neuroscience, Neurotransmission, Phospho Specific, Potassium Channels |
Antigen | Potassium Channel Kv3.1 |
Regulatory Status | RUO |
Purification Method | Ammonium sulfate precipitation |
Dilution | Western Blot : 5-10 μg/mL |
Gene Alias | FLJ41162, FLJ42249, FLJ43491, KV3.1, KV4, MGC129855, NGK2, potassium voltage-gated channel subfamily C member 1, potassium voltage-gated channel, Shaw-related subfamily, member 1, voltage-gated potassium channel protein KV3.1, Voltage-gated potassium channel subunit Kv3.1, Voltage-gated potassium channel subunit Kv4 |
Gene ID (Entrez) | 3746 |
Formulation | Phosphate buffered saline |
Immunogen | Rabbits were immunized with a synthetic peptide derived from the rat Potassium Channel Kv3.1 conjugated to KLH |
Classification | Polyclonal |
Primary or Secondary | Primary |
Potassium Channel Kv3.1 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | P48547 |
Research Discipline | Neuronal Cell Markers, Neuroscience, Neurotransmission, Potassium Channels |
Antigen | Potassium Channel Kv3.1 |
Gene Symbols | KCNC1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Gene Alias | FLJ41162, FLJ42249, FLJ43491, KV3.1, KV4, MGC129855, NGK2, potassium voltage-gated channel subfamily C member 1, potassium voltage-gated channel, Shaw-related subfamily, member 1, voltage-gated potassium channel protein KV3.1, Voltage-gated potassium channel subunit Kv3.1, Voltage-gated potassium channel subunit Kv4 |
Gene ID (Entrez) | 3746 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDS |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Potassium Channel Kv2.2 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Autophagy, Neuronal Cell Markers, Neuroscience, Neurotransmission, Potassium Channels |
Antigen | Potassium Channel Kv2.2 |
Gene Symbols | KCNB2 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | delayed rectifier potassium channel protein, KV2.2, potassium channel Kv2.2, potassium voltage-gated channel subfamily B member 2, potassium voltage-gated channel, Shab-related subfamily, member 2, voltage-gated potassium channel subunit Kv2.2 |
Gene ID (Entrez) | 9312 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QHISTILLEETPSQGDRPLLGTEVSAPCQGPSKGLSPRFPKQKLFPFSSRERRSFTEIDTGDDEDFLELP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Maxi Potassium channel alpha Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | Q12791 |
Research Discipline | Potassium Channels |
Antigen | Maxi Potassium channel alpha |
Gene Symbols | KCNMA1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Gene Alias | bA205K10.1, BK channel, BKCA alpha, BKCA alpha subunit, BKTM, calcium-activated potassium channel subunit alpha-1, DKFZp686K1437, hSlo, k(VCA)alpha, KCNMA, Maxi K channel, MaxiK, MGC71881, potassium large conductance calcium-activated channel, subfamily M, alphamember 1, SAKCA, Slo homolog, Slo1, SLO-ALPHA, Slowpoke homolog, stretch-activated Kca channel, subfamily M subunit alpha-1 |
Gene ID (Entrez) | 3778 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: INLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | P51164 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Maxi Potassium channel alpha Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 1 publication
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Form | Antisera |
Isotype | IgG |
Gene Accession No. | Q62976 |
Research Discipline | Potassium Channels |
Concentration | LYOPH |
Antigen | Maxi Potassium channel alpha |
Gene Symbols | KCNMA1 |
Regulatory Status | RUO |
Purification Method | Unpurified |
Gene Alias | bA205K10.1, BK channel, BKCA alpha, BKCA alpha subunit, BKTM, calcium-activated potassium channel subunit alpha-1, DKFZp686K1437, hSlo, k(VCA)alpha, KCNMA, Maxi K channel, MaxiK, MGC71881, potassium large conductance calcium-activated channel, subfamily M, alphamember 1, SAKCA, Slo homolog, Slo1, SLO-ALPHA, Slowpoke homolog, stretch-activated Kca channel, subfamily M subunit alpha-1 |
Gene ID (Entrez) | 3778 |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Rat, mouse. Other species not yet tested. |
Content And Storage | Stable for one year at 2°C to 8°C from date of receipt. |
---|---|
Host Species | Mouse |
Applications | Immunohistochemistry (Paraffin),Western Blot |
Form | Purified |
Isotype | IgM κ |
Gene Accession No. | P78508 |
Antigen | Potassium Channel Kir4.1 |
Regulatory Status | RUO |
Gene Symbols | KCNJ10; SESAMES |
Purification Method | Purified by Ion-Exchange Chromatography |
Gene ID (Entrez) | NP_002232 |
Formulation | Purified mouse monoclonal IgMκ antibody in PBS with 0.05% sodium azide. |
Classification | Monoclonal |
Immunogen | KLH-conjugated linear peptides corresponding to sequences from the first extracellular domain and the C-terminal cytoplasmic tail of human potassium channel Kir4.1. |
Primary or Secondary | Primary |
Clone | 9C9.2 |
Potassium Channel Kv2.2 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 1 publication
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | P51164 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Molecular Weight of Antigen | 33 kDa |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Immunogen | Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | This product is specific to Subunit or Isoform: beta. |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | P51164 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Antigen | Hydrogen Potassium ATPase Beta |
---|---|
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Gene ID (Entrez) | 496 |
Immunogen | Synthetic peptide directed towards the C terminal of human Atp4b. Peptide sequence QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL. |
Classification | Polyclonal |
Isotype | IgG |
Gene Accession No. | NP_036642 |
Primary or Secondary | Primary |
Maxi Potassium channel beta Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 5 publications
Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | Q16558 |
Research Discipline | Potassium Channels |
Concentration | 1 mg/mL |
Antigen | Maxi Potassium channel beta |
Gene Symbols | KCNMB1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 2.0 μg/mL, Flow Cytometry, Immunohistochemistry 1:200 - 1:2000, Immunocytochemistry/Immunofluorescence 1:100 - 1:200, Immunohistochemistry-Paraffin 1:200 - 1:2000, Knockdown Validated |
Gene Alias | BK channel beta subunit, BK channel subunit beta-1, BKbeta, BKbeta1, Calcium-activated potassium channel subunit beta, calcium-activated potassium channel subunit beta-1, Calcium-activated potassium channel, subfamily M subunit beta-1, Charybdotoxin receptor subunit beta-1, Hbeta1, hslo-beta, K(VCA)beta, k(VCA)beta-1, large conductance Ca2+-activated K+ channel beta 1 subunit, Maxi K channel beta subunit, Maxi K channel subunit beta-1, potassium large conductance calcium-activated channel, subfamily M, beta member1, Slo-beta, Slo-beta-1 |
Gene ID (Entrez) | 3779 |
Formulation | PBS, 1 mg/ml BSA with 0.05% Sodium Azide |
Immunogen | Synthetic Peptide: L(90) Y H T E D T R D Q N Q Q C(103) |
Classification | Polyclonal |
Primary or Secondary | Primary |
MilliporeSigma™ Potassium Channel Kir6.2, Mouse, Unlabeled, Clone: 10C1.1,
Mouse Monoclonal Antibody
Antigen | Potassium Channel Kir6.2 |
---|---|
Regulatory Status | RUO |
Content And Storage | Stable for 1 year at 2°-8°C from date of receipt. |
Host Species | Mouse |
Applications | Western Blot |
Form | Purified |
Formulation | Purified mouse monoclonal IgG1κ antibody in buffer containing 0.1M Tris-Glycine (pH 7.4), 150mM NaCl with 0.05% Sodium Azide. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 10C1.1 |
Antigen | Potassium Channel Kir3.4 |
---|---|
Regulatory Status | RUO |
Content And Storage | Stable for 1 year at 2°-8°C from date of receipt. |
Host Species | Mouse |
Applications | Western Blot |
Form | Purified |
Formulation | Purified mouse IgG1 in buffer containing 0.1M Tris-Glycine (pH 7.4), 150mM NaCl with 0.05% Sodium Azide. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 8F4.1 |
Sodium Potassium ATPase Alpha 3 Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Antigen | Sodium Potassium ATPase Alpha 3 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Immunohistochemistry-Paraffin 1:200-1:1000 |
Gene Alias | alpha 3 polypeptide, ATPase, Na+/K+ transporting, alpha 3 polypeptide, dystonia 12, DYT12, EC 3.6.3, MGC13276, RDP, Sodium pump subunit alpha-3, sodium/potassium-transporting ATPase alpha-3 chain, sodium/potassium-transporting ATPase subunit alpha-3 |
Gene ID (Entrez) | 478 |
Formulation | PBS (pH 7.0) |
Immunogen | Produced in rabbits immunized with a synthetic peptide corresponding to the N-terminus of the Mouse Sodium Potassium ATPase Alpha 3. |
Classification | Polyclonal |
Primary or Secondary | Primary |