Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hydrogen Potassium ATPase Beta Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$204.00 - $482.50
Specifications
| Antigen | Hydrogen Potassium ATPase Beta |
|---|---|
| Immunogen | Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16002820
|
Novus Biologicals
NBP16002820UL |
20ul |
Each for $204.00
|
|
|||||
|
NBP160028
|
Novus Biologicals
NBP160028 |
100 μL |
Each for $482.50
|
|
|||||
Description
Hydrogen Potassium ATPase Beta Polyclonal specifically detects Hydrogen Potassium ATPase Beta in Human samples. It is validated for Western Blot.Specifications
| Hydrogen Potassium ATPase Beta | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 496 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK. | |
| Primary | |
| IgG | |
| ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title