accessibility menu, dialog, popup

Test

Viewing profile as user:

Antibodies

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (2,190)
Antibody Panels and Kits (2)
Secondary Antibodies (1)
Isotype Controls and Standards (1)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

carbon

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (6)
  • (14)
  • (25)
  • (8)
  • (7)
  • (3)
  • (1)
  • (1)
  • (2)
  • (1)
  • (1)
  • (3)
  • (3)
  • (18)
  • (4)
  • (2)
  • (186)
  • (1)
  • (2)
  • (1,573)
  • (3)
  • (15)
  • (92)
  • (1)
  • (31)
  • (3)
  • (82)
  • (276)
  • (2)

special interests

  • (2)
  • (1,661)

Applications

  • (2)
  • (31)
  • (2)
  • (1)
  • (1,107)
  • (8)
  • (8)
Show all

Conjugate

  • (39)
  • (3)
  • (46)
  • (46)
  • (46)
  • (45)
  • (46)
Show all

Host Species

  • (2)
  • (61)
  • (12)
  • (541)
  • (1,414)
  • (8)
  • (8)

Quantity

  • (3)
  • (4)
  • (2)
  • (1,391)
  • (15)
  • (5)
  • (3)
Show all

Target Species

  • (14)
  • (25)
  • (181)
  • (5)
  • (1,602)
  • (602)
  • (11)
Show all

Classification

  • (1,305)
  • (699)
  • (41)

Isotype

  • (1,468)
  • (3)
  • (182)
  • (10)
  • (3)
  • (59)
  • (34)
Show all

Regulatory Status

  • (2,006)

Form

  • (1)
  • (314)
  • (54)
  • (1,503)
  • (3)
  • (2)
1 – 15 of 2,093 results
1

Carbonic Anhydrase VI Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Lipid and Metabolism
Antigen Carbonic Anhydrase VI
Gene Symbols CA6
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias Carbonate dehydratase VI, carbonic anhydrase 6, carbonic anhydrase VIGUSTIN, CA-VI, EC 4.2.1.1, MGC21256, Salivary carbonic anhydrase, Secreted carbonic anhydrase
Gene ID (Entrez) 765
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
2

Carbonic Anhydrase I Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage -20°C or -80°C if preferred
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Form Liquid
Isotype IgG
Gene Accession No. P00915, P13634
Antigen Carbonic Anhydrase I
Gene Symbols CA1, Car1
Regulatory Status RUO
Gene Alias AW555628, CA I, CA1, ca1 {ECO:0000250, CAB, CA-I, CA-I {ECO:0000250, Car1, Car-1, Carbonate dehydratase I, carbonate dehydratase I {ECO:0000250, carbonic anhydrase 1, carbonic anhydrase 1 {ECO:0000250, Carbonic anhydrase B, carbonic anhydrase I, carbonic anhydrase I {ECO:0000250, epididymis secretory protein Li 11, HEL-S-11, UniProtKB:P00915}
Gene CA1
Product Type Antibody
Gene ID (Entrez) 12346, 759
Classification Polyclonal
Primary or Secondary Primary
3

Carbonic Anhydrase VI Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG
Concentration 0.5 mg/mL
Antigen Carbonic Anhydrase VI
Gene Symbols Car6
Regulatory Status RUO
Purification Method Protein A
Gene Alias CA6, CA-6, Car6, Carbonate dehydratase VI, carbonic anhydrase 6, Carbonic anhydrase VI, carbonic anhydrase VI nirs variant 2, Carbonic anhydrase6, CA-VI, DOC1, GUSTIN, salivary carbonic anhydrase, Secreted carbonic anhydrase
Gene Car6
Gene ID (Entrez) 298657
Formulation PBS with 50% glycerol and 0.05% Proclin 300, pH 7.4
Immunogen Recombinant Rat CA6 protein, Thr147-Ala275 (Accession #F1LQ08)
Classification Polyclonal
Primary or Secondary Primary
4

Carbonic Anhydrase VA Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P23589, P43165
Concentration 0.5 mg/mL
Antigen Carbonic Anhydrase VA
Gene Symbols CA5A, Car5a
Regulatory Status RUO
Purification Method Protein A
Gene Alias CA Y, CA5, CA5A, CA5AD, Car5, Car5a, Carbonate dehydratase VA, carbonic anhydrase 5 mitochondrial, carbonic anhydrase 5, mitochondrial, carbonic anhydrase 5A, carbonic anhydrase 5a, mitochondrial, carbonic anhydrase 5b, mitochondrial, carbonic anhydrase V, mitochondrial, carbonic anhydrase VA, carbonic anhydrase VA, mitochondrial, carbonic dehydratase, CAV, CAVA, CA-VA, GS1-21A4.1
Gene Car5a
Gene ID (Entrez) 12352, 54233
Formulation PBS with 50% glycerol and 0.05% Proclin 300, pH 7.4
Immunogen Recombinant Rat CA5A protein, Tyr12-Leu219 (Accession #P43165)
Classification Polyclonal
Primary or Secondary Primary
5

Carbonic Anhydrase IV Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Porcine,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P22748, P48284, Q64444
Concentration 0.5 mg/mL
Antigen Carbonic Anhydrase IV
Gene Symbols CA4, Car4
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AW456718, CA IV, CA4, CAIV, CA-IV, Car4, Carbonate dehydratase IV, carbonic anhydrase 4, Carbonic anhydrase IV, carbonic dehydratase IV, RP17
Gene CA4
Gene ID (Entrez) 100511956, 12351, 29242, 762
Formulation PBS with 50% glycerol and 0.05% Proclin 300, pH 7.4
Immunogen Recombinant Rat CA4 protein, Ser20-Ser220 (Accession #P48284)
Classification Polyclonal
Primary or Secondary Primary
6

Carbonic Anhydrase III Monoclonal Antibody (5G8B6), Invitrogen™

Mouse Monoclonal Antibody

ENCOMPASS
Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA
Form Liquid
Isotype IgG1
Gene Accession No. P07451
Concentration 1 mg/mL
Antigen Carbonic Anhydrase III
Gene Symbols Ca3
Regulatory Status RUO
Purification Method Protein A
Gene Alias BB219044; CA III; Ca3; CAH3; CAIII; CA-III; CAIII (Muscle); Car3; Car-3; Carbonate dehydratase III; carbonic anhydrase 3; Carbonic anhydrase III; carbonic anhydrase III, muscle specific; carbonic anhydrase-like protein; EC 4.2.1.1; epididymis secretory sperm binding protein Li 167mP; HEL-S-167mP
Gene Ca3
Product Type Antibody
Gene ID (Entrez) 761
Formulation PBS with no preservative
Immunogen Recombinant Human Carbonic Anhydrase III/CA3 Protein.
Classification Monoclonal
Primary or Secondary Primary
Clone 5G8B6
7

Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. Q86YU0
Research Discipline Lipid and Metabolism
Antigen Carbonic Anhydrase VII/CA7
Gene Symbols CA7
Regulatory Status RUO
Molecular Weight of Antigen 23 kDa
Gene Alias Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1
Gene ID (Entrez) 766
Immunogen Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR.
Classification Polyclonal
Primary or Secondary Primary
8

Carbonic Anhydrase XIV/CA14 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,ELISA
Form Purified
Isotype IgG
Research Discipline Lipid and Metabolism
Antigen Carbonic Anhydrase XIV/CA14
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:1000, ELISA 1:5000-1:10000
Gene Alias Carbonate dehydratase XIV, carbonic anhydrase XIVcarbonic anhydrase 14, carbonic dehydratase, CAXiV, CA-XIV, EC 4.2.1.1
Gene ID (Entrez) 23632
Formulation 0.2 um filtered solution in PBS
Immunogen Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase XIV/CA14 (Accession#: NP_035927.1; Met 1-Met 290)
Classification Polyclonal
Primary or Secondary Primary
9

Carbonic Anhydrase XIV/CA14 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Lipid and Metabolism
Antigen Carbonic Anhydrase XIV/CA14
Gene Symbols CA14
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Gene Alias Carbonate dehydratase XIV, carbonic anhydrase XIVcarbonic anhydrase 14, carbonic dehydratase, CAXiV, CA-XIV, EC 4.2.1.1
Gene ID (Entrez) 23632
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGIL
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
10

Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Gene Accession No. P35219
Research Discipline Lipid and Metabolism
Antigen Carbonic Anhydrase VIII/CA8
Gene Symbols CA8
Regulatory Status RUO
Purification Method Protein A purified
Molecular Weight of Antigen 32 kDa
Gene Alias CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502
Gene ID (Entrez) 767
Immunogen Synthetic peptides corresponding to CA8(carbonic anhydrase VIII) The peptide sequence was selected from the N terminal of CA8. Peptide sequence YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC.
Classification Polyclonal
Primary or Secondary Primary
11

Carbonic Anhydrase III Monoclonal Antibody (C2), Invitrogen™

Mouse Monoclonal Antibody

ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Porcine,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG2b κ
Gene Accession No. P07451, P14141, P16015, Q5S1S4
Concentration 1 mg/mL
Antigen Carbonic Anhydrase III
Gene Symbols Ca3, Car3
Regulatory Status RUO
Purification Method Protein A/G
Gene Alias BB219044, CA III, Ca3, CAH3, CAIII, CA-III, CAIII (Muscle), Car3, Car-3, Carbonate dehydratase III, carbonic anhydrase 3, Carbonic anhydrase III, carbonic anhydrase III, muscle specific, carbonic anhydrase-like protein, EC 4.2.1.1, epididymis secretory sperm binding protein Li 167mP, HEL-S-167mP
Gene Ca3
Gene ID (Entrez) 12350, 494016, 54232, 761
Formulation PBS with 50% glycerol and 0.05% Proclin 300, pH 7.4
Immunogen Recombinant Human CA3 protein, Ala2-Lys260 (Accession #P07451)
Classification Monoclonal
Primary or Secondary Primary
Clone C2
12

Carbonic Anhydrase XII/CA12 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Research Discipline Lipid and Metabolism
Antigen Carbonic Anhydrase XII/CA12
Gene Symbols CA12
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias Carbonate dehydratase XII, carbonic anhydrase 12, carbonic anhydrase XIICAXII, carbonic dehydratase, CA-XII, EC 4.2.1.1, FLJ20151, HsT18816, Tumor antigen HOM-RCC-3.1.3
Gene ID (Entrez) 771
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAEL
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
13

Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG
Research Discipline Lipid and Metabolism
Antigen Carbonic Anhydrase VII/CA7
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution ELISA 1:5000-1:10000
Gene Alias Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1
Gene ID (Entrez) 766
Formulation 0.2 um filtered solution in PBS
Immunogen Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VII/CA7 (Accession#: P43166; Met1-Ala264)
Classification Polyclonal
Primary or Secondary Primary
14

Carbonic Anhydrase VA/CA5A Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,ELISA
Form Purified
Isotype IgG
Research Discipline Lipid and Metabolism
Antigen Carbonic Anhydrase VA/CA5A
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:1000, ELISA 1:25000-1:50000
Gene Alias CA5carbonic anhydrase 5A, mitochondrial, Carbonate dehydratase VA, carbonic anhydrase V, mitochondrial, Carbonic anhydrase VA, carbonic anhydrase VA, mitochondrial, carbonic dehydratase, CAV, CAVA, CA-VA, EC 4.2.1.1
Gene ID (Entrez) 763
Formulation 0.2 um filtered solution in PBS
Immunogen Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VA/CA5A (Accession#: NP_001730.1; Ala 40-Ser 305)
Classification Polyclonal
Primary or Secondary Primary
15

Carbonic Anhydrase XIII/CA13 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,ELISA,Immunoprecipitation
Form Purified
Isotype IgG
Research Discipline Lipid and Metabolism
Antigen Carbonic Anhydrase XIII/CA13
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 4-6 uL/mg of lysate
Gene Alias carbonic anhydrase 13, carbonic anhydrase XIIICarbonate dehydratase XIII, CAXIII, CA-XIII, EC 4.2.1.1, FLJ37995, MGC59868
Gene ID (Entrez) 377677
Formulation 0.2 um filtered solution in PBS
Immunogen Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase XIII/CA13 (Accession#: NP_940986.1; Met 1-His 262)
Classification Polyclonal
Primary or Secondary Primary