Filtered Search Results
Search results for "dopamine"
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Bovine,Human,Mouse,Rat |
Host Species | Sheep |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Frozen),Western Blot |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P09172, P15101, Q05754, Q64237 |
Concentration | Conc. Not Determined |
Antigen | Dopamine beta Hydroxylase |
Gene Symbols | DBH |
Regulatory Status | RUO |
Gene Alias | Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase |
Gene | DBH |
Product Type | Antibody |
Gene ID (Entrez) | 13166, 1621, 25699, 280758 |
Formulation | whole serum with 0.05% sodium azide |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine hydrochloride, 99%, Thermo Scientific Chemicals
CAS: 62-31-7 Molecular Formula: C8H12ClNO2 Molecular Weight (g/mol): 189.64 MDL Number: MFCD00012898 InChI Key: CTENFNNZBMHDDG-UHFFFAOYSA-N Synonym: dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril PubChem CID: 65340 IUPAC Name: 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride SMILES: [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1
PubChem CID | 65340 |
---|---|
CAS | 62-31-7 |
Molecular Weight (g/mol) | 189.64 |
MDL Number | MFCD00012898 |
SMILES | [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1 |
Synonym | dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril |
IUPAC Name | 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride |
InChI Key | CTENFNNZBMHDDG-UHFFFAOYSA-N |
Molecular Formula | C8H12ClNO2 |
Novus Biologicals™ Dopamine D5R/DRD5 Overexpression Lysate
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Dopamine beta-Hydroxylase Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Cancer, Lipid and Metabolism, Neuroscience |
Antigen | Dopamine beta-Hydroxylase |
Gene Symbols | DBH |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Gene Alias | DBM, dopamine beta-hydroxylase, dopamine beta-hydroxylase (dopamine beta-monooxygenase), Dopamine beta-monooxygenase, EC 1.14.17.1 |
Gene ID (Entrez) | 1621 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Antigen | Dopamine D2 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide (CAARRAQELEME) corresponding to amino acids 272-282 of human D2 dopamine receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the dopamine D2 receptor in rat brain. Does not cross-react with other dopamine receptors and exhibits minimal cross-reactivity with the D2S short receptor. |
Antigen | Dopamine D3 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Flow Cytometry,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide (ASLSQLSSHC) corresponding to amino acids (2-10) of human dopamine D3 receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the dopamine D3 receptor in rat brain. Does not cross-react with other dopamine receptors. |
Antigen | Dopamine D1 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Immunoblot,Immunoblot,Immunohistochemistry (Frozen) |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide (MDGTGLVVERDFSC) corresponding to amino acids 9-21 of human D1,subscript_end;dopamine receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the dopamine D1 receptor in rat brain. Does not cross-react with other dopamine receptors. |
Novus Biologicals™ Dopamine D2R/DRD2 Overexpression Lysate
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Dopamine hydrochloride, Tocris Bioscience™
CAS: 62-31-7 Molecular Formula: C8H12ClNO2 Molecular Weight (g/mol): 189.64 MDL Number: MFCD00012898 InChI Key: CTENFNNZBMHDDG-UHFFFAOYSA-N Synonym: dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril PubChem CID: 65340 IUPAC Name: hydrogen 4-(2-aminoethyl)benzene-1,2-diol chloride SMILES: [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1
PubChem CID | 65340 |
---|---|
CAS | 62-31-7 |
Molecular Weight (g/mol) | 189.64 |
MDL Number | MFCD00012898 |
SMILES | [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1 |
Synonym | dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril |
IUPAC Name | hydrogen 4-(2-aminoethyl)benzene-1,2-diol chloride |
InChI Key | CTENFNNZBMHDDG-UHFFFAOYSA-N |
Molecular Formula | C8H12ClNO2 |
Antigen | Dopamine D5 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Flow Cytometry,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide (LPPGSNGTAYC) corresponding to amino acids 2-10 of human dopamine D5 receptor,conjugated to carrier protein |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the dopamine D5 receptor in rat brain. Does not cross-react with other dopamine receptors. |
Antigen | Dopamine D2S Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic (PLKEAARRC) peptide corresponding to amino acids 239-246 of human D2s dopamine receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the ∽48kDa dopamine D25 receptor. Does not cross-react with other dopamine receptors. |
Novus Biologicals™ Dopamine beta-Hydroxylase Overexpression Lysate
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More