All Primary Antibodies
All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (4)
- (1)
- (4)
- (5)
- (2)
- (79)
- (3)
- (51)
- (18)
- (3)
- (5)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (4)
- (1)
- (1)
- (1)
- (9)
- (17)
- (39)
- (10)
- (10)
- (34)
- (5)
- (75)
- (36)
- (54)
- (4)
- (4)
- (23)
- (67)
Filtered Search Results
Oxygen-regulated protein 1 Rabbit anti-Human∣Mouse∣Rat, Polyclonal, Bioss
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P56715, P56716 |
Concentration | 2 mg/mL |
Antigen | RP1 |
Gene Symbols | RP1 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | Dcdc3; DCDC4A; mG145; Orp1; oxygen-regulated protein 1; retinitis pigmentosa 1 (autosomal dominant); retinitis pigmentosa 1 (human); retinitis pigmentosa 1 homolog; retinitis pigmentosa 1 protein; Retinitis pigmentosa RP1 protein; retinitis pigmentosa RP1 protein homolog; RP1; Rp1h |
Gene | RP1 |
Product Type | Antibody |
Gene ID (Entrez) | 19888, 6101 |
Formulation | PBS with 0.05% sodium azide |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P56715 |
Concentration | 0.3 mg/mL |
Antigen | RP1 |
Gene Symbols | RP1 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | Dcdc3; DCDC4A; mG145; Orp1; oxygen-regulated protein 1; retinitis pigmentosa 1 (autosomal dominant); retinitis pigmentosa 1 (human); retinitis pigmentosa 1 homolog; retinitis pigmentosa 1 protein; Retinitis pigmentosa RP1 protein; retinitis pigmentosa RP1 protein homolog; RP1; Rp1h |
Gene | RP1 |
Product Type | Antibody |
Gene ID (Entrez) | 6101 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Classification | Polyclonal |
Primary or Secondary | Primary |
Cathepsin K Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Cancer |
Antigen | Cathepsin K |
Gene Symbols | CTSK |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD |
Gene ID (Entrez) | 1513 |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
ORP150/HSP12A Antibody (6G7-2H5), Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Host Species | Mouse |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry,Immunofluorescence |
Form | Purified |
Isotype | IgG2a |
Research Discipline | Hypoxia |
Antigen | ORP150/HSP12A |
Gene Symbols | HYOU1 |
Regulatory Status | RUO |
Purification Method | Protein G purified |
Dilution | Western Blot 1:100 - 1:2000, Immunocytochemistry/Immunofluorescence 1:10 - 1:500 |
Gene Alias | 150 kDa oxygen-regulated protein, 170 kDa glucose-regulated protein, DKFZp686N08236, FLJ97572, glucose-regulated protein 170, GRP170, GRP-170, HSP12A, hypoxia up-regulated 1, hypoxia up-regulated protein 1, ORP-150, ORP150FLJ94899, oxygen regulated protein (150kD) |
Gene ID (Entrez) | 10525 |
Immunogen | Raised against a synthetic peptide of human GRP170 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Detects 170kDa. |
Clone | 6G7-2H5 |
ORP150/HSP12A Antibody (6E3-2C3), Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Target Species | Human,Mouse,Rat |
---|---|
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry,Immunofluorescence |
Form | Purified |
Isotype | IgG2b |
Research Discipline | Hypoxia |
Antigen | ORP150/HSP12A |
Gene Symbols | HYOU1 |
Regulatory Status | RUO |
Purification Method | Protein G purified |
Dilution | Western Blot 1:100 - 1:2000, Immunocytochemistry/Immunofluorescence 1:10 - 1:500 |
Gene Alias | 150 kDa oxygen-regulated protein, 170 kDa glucose-regulated protein, DKFZp686N08236, FLJ97572, glucose-regulated protein 170, GRP170, GRP-170, HSP12A, hypoxia up-regulated 1, hypoxia up-regulated protein 1, ORP-150, ORP150FLJ94899, oxygen regulated protein (150kD) |
Gene ID (Entrez) | 10525 |
Immunogen | Recombinant Full length GRP170 Protein |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Detects 170 kDa. |
Clone | 6E3-2C3 |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | Q8TD55 |
Concentration | 0.2 mg/mL |
Antigen | PLEKHO2 |
Gene Symbols | PLEKHO2 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | AI840980; PH domain-containing family O member 2; PH domain-containing family Q member 1; PH domain-containing protein; PH domain-containing protein homolog; pleckstrin homology domain containing O2; pleckstrin homology domain containing, family O member 2; pleckstrin homology domain containing, family Q member 1; pleckstrin homology domain-containing family O member 2; Pleckstrin homology domain-containing family Q member 1; PLEKHO2; Plekhq1; PP1628; pp9099 |
Gene | PLEKHO2 |
Product Type | Antibody |
Gene ID (Entrez) | 80301 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA,Western Blot |
Form | Liquid |
Isotype | IgG1 κ |
Gene Accession No. | Q8TD55 |
Antigen | PLEKHO2 |
Gene Symbols | PLEKHO2 |
Regulatory Status | RUO |
Purification Method | Protein A |
Gene Alias | AI840980; PH domain-containing family O member 2; PH domain-containing family Q member 1; PH domain-containing protein; PH domain-containing protein homolog; pleckstrin homology domain containing O2; pleckstrin homology domain containing, family O member 2; pleckstrin homology domain containing, family Q member 1; pleckstrin homology domain-containing family O member 2; Pleckstrin homology domain-containing family Q member 1; PLEKHO2; Plekhq1; PP1628; pp9099 |
Gene | PLEKHO2 |
Product Type | Antibody |
Gene ID (Entrez) | 80301 |
Formulation | PBS with no preservative; pH 7.4 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 3D9 |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Western Blot |
Form | Liquid |
Isotype | IgG1 |
Gene Accession No. | Q9BQA9 |
Concentration | 1 mg/mL |
Antigen | C17orf62 |
Gene Symbols | C17ORF62 |
Regulatory Status | RUO |
Purification Method | Affinity Chromatography |
Gene Alias | C17orf62; chromosome 17 open reading frame 62; CYBC1; Cytochrome b-245 chaperone 1; EROS; Essential for reactive oxygen species protein; HAPSTR1; uncharacterized protein C17orf62 |
Gene | C17ORF62 |
Product Type | Antibody |
Gene ID (Entrez) | 79415 |
Formulation | PBS with 1% BSA, 50% glycerol and 0.02% sodium azide; pH 7.3 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | OTI2B8 |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | Q9HA92 |
Concentration | 0.5 mg/mL |
Antigen | RSAD1 |
Gene Symbols | RSAD1 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography, Protein A |
Gene Alias | B430319G23; BC056485; oxygen-independent coproporphyrinogen-III oxidase-like protein RSAD1; Putative heme chaperone; radical S-adenosyl methionine domain containing 1; radical S-adenosyl methionine domain-containing protein 1, mitochondrial; RSAD1 |
Gene | RSAD1 |
Product Type | Antibody |
Gene ID (Entrez) | 55316 |
Formulation | PBS with 0.09% sodium azide |
Classification | Polyclonal |
Primary or Secondary | Primary |
Cathepsin K Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | NP_000387 |
Research Discipline | Cancer |
Antigen | Cathepsin K |
Gene Symbols | CTSK |
Regulatory Status | RUO |
Molecular Weight of Antigen | 37 kDa |
Gene Alias | cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD |
Gene ID (Entrez) | 1513 |
Immunogen | Synthetic peptide directed towards the middle region of human CTSK. Peptide sequence SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY. |
Classification | Polyclonal |
Primary or Secondary | Primary |
NDRG1 Mouse anti-Human, Clone: 11G4, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,ELISA,Immunocytochemistry,Immunofluorescence |
Form | Purified |
Isotype | IgG1 κ |
Research Discipline | Cancer |
Concentration | 1 mg/mL |
Antigen | NDRG1 |
Gene Symbols | NDRG1 |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Western Blot 1:1000, Flow Cytometry 1:10-1:1025, ELISA, Immunocytochemistry/Immunofluorescence 1:100 |
Gene Alias | CAP43, CMT4D, Differentiation-related gene 1 protein, DRG-1, DRG1HMSNL, NDR1, Nickel-specific induction protein Cap43, NMSL, N-myc downstream regulated 1, N-myc downstream-regulated gene 1 protein, protein NDRG1, protein regulated by oxygen-1, PROXY1, Reducing agents and tunicamycin-responsive protein, RIT42, RTPGC4, TARG1, TDD5, tunicamycin-responsive protein |
Gene ID (Entrez) | 10397 |
Formulation | Liquid. In PBS (pH 7.4), 10% Glycerol with 0.02% Sodium Azide |
Immunogen | Recombinant human NDRG1 (1-394aa) purified from E. coli |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 11G4 |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Western Blot |
Form | Liquid |
Isotype | IgG1 |
Gene Accession No. | Q9BQA9 |
Concentration | 1 mg/mL |
Antigen | C17orf62 |
Gene Symbols | C17ORF62 |
Regulatory Status | RUO |
Purification Method | Affinity Chromatography |
Gene Alias | C17orf62; chromosome 17 open reading frame 62; CYBC1; Cytochrome b-245 chaperone 1; EROS; Essential for reactive oxygen species protein; HAPSTR1; uncharacterized protein C17orf62 |
Gene | C17ORF62 |
Product Type | Antibody |
Gene ID (Entrez) | 79415 |
Formulation | PBS with 1% BSA, 50% glycerol and 0.02% sodium azide; pH 7.3 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | OTI3F10 |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | Q9BQA9 |
Concentration | 0.5 mg/mL |
Antigen | C17orf62 |
Gene Symbols | C17ORF62 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | C17orf62; chromosome 17 open reading frame 62; CYBC1; Cytochrome b-245 chaperone 1; EROS; Essential for reactive oxygen species protein; HAPSTR1; uncharacterized protein C17orf62 |
Gene | C17ORF62 |
Product Type | Antibody |
Gene ID (Entrez) | 79415 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Classification | Polyclonal |
Primary or Secondary | Primary |