Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cathepsin K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $627.50
Specifications
| Antigen | Cathepsin K |
|---|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Classification | Polyclonal |
Description
Cathepsin K Polyclonal specifically detects Cathepsin K in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Cathepsin K | |
| Rabbit | |
| Polyclonal | |
| IgG | |
| cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| Immunocytochemistry, Immunofluorescence | |
| RUO |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF | |
| Primary | |
| Human | |
| Unconjugated | |
| 1513 | |
| Affinity Purified | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title