All Primary Antibodies
All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (1)
- (16)
- (22)
- (51)
- (4)
- (13)
- (60)
- (8)
- (45)
- (14)
- (137)
- (37)
- (145)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (165)
- (1)
- (1)
- (1)
- (1)
- (1)
- (32)
- (150)
- (152)
- (6)
- (2)
- (7)
- (8)
- (8)
- (1)
Filtered Search Results
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Antigen | Hydrogen Potassium ATPase Beta |
---|---|
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Gene ID (Entrez) | 496 |
Immunogen | Synthetic peptide directed towards the C terminal of human Atp4b. Peptide sequence QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL. |
Classification | Polyclonal |
Isotype | IgG |
Gene Accession No. | NP_036642 |
Primary or Secondary | Primary |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | P51164 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 1 publication
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | P51164 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Molecular Weight of Antigen | 33 kDa |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Immunogen | Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | This product is specific to Subunit or Isoform: beta. |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | P51164 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Hydrogen Potassium ATPase Beta Antibody (2G11), Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody has been used in 5 publications
Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Ascites |
Isotype | IgG1 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Purification Method | Unpurified |
Dilution | Western Blot 1:4000, Flow Cytometry 1:50, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10 - 1:500, Immunohistochemistry-Paraffin 1:2000, Immunohistochemistry-Frozen 1:2000, Dot Blot 1:100 - 1:2000, Chromatin Immunoprecipitation (ChIP) 1:10-1:500 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Immunogen | Purified 34 kDa core peptide from deglycosylated hog gastric microsomes. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Detects the beta-subunit of hydrogen/potassium ATPase. |
Clone | 2G11 |
Hydrogen Potassium ATPase Beta Antibody (SR1980), Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Store at -20° C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Endocrinology, Signal Transduction |
Antigen | Hydrogen Potassium ATPase Beta |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS, pH 7.4, 150mM NaCl, 50% glycerol. |
Immunogen | A synthesized peptide derived from human Hydrogen Potassium ATPase Beta (Uniprot #: P51164) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | SR1980 |
Hydrogen Potassium ATPase Beta Antibody (2G11), Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody has been used in 5 publications
Hydrogen Potassium ATPase Beta Rabbit anti-Human, Mouse, Rat, Clone: 3Y1Y1, Novus Biologicals™
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | Endocrinology, Signal Transduction |
Antigen | Hydrogen Potassium ATPase Beta |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 192-291 of human Hydrogen Potassium ATPase Beta (P51164). |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 3Y1Y1 |
hydrogen exchanger 3 Rabbit anti-Human, Polyclonal, Bioss
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sodium/Hydrogen Exchanger 1 Rabbit anti-Human, Polyclonal, Bioss
Supplier Diversity Partner
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Small and/or diverse supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sodium/Hydrogen Exchanger 1 Rabbit anti-Human, Mouse, Non-human Primate, Rat, Polyclonal, FabGennix
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Bovine,Canine,Human,Mouse,Mustelid,Porcine,Rabbit,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ChIP Assay,Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot |
Form | Liquid |
Isotype | IgG1 |
Gene Accession No. | P18434, P18597, P18598, P33704, P50992, P51164 |
Concentration | Conc. Not Determined |
Antigen | ATP4B |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Gene Alias | (H+,K+)-ATPase beta-subunit; ATP4B; ATP6B; ATPase H+/K+ transporting beta subunit; ATPase H+/K+ transporting subunit beta; ATPase H+K+-transporting beta / (gastric HK-ATPase beta subunit) defined by SSR; ATPase, H+,K+-transporting, beta / (gastric H,K-ATPase beta subunit), defined by SSR; ATPase, H+/K+ exchanging, beta polypeptide; ATPase, H+/K+ transporting, beta polypeptide; ATPase, H+/K+ transporting, beta polypeptide, gastric specific; AV080843; gastric H(+)/K(+) ATPase subunit beta; gastric H+/K+ ATPase beta subunit; gastric H+/K+-ATPase beta subunit; gastric hydrogen-potassium ATPase, beta; gp60-90; H,K-ATPase-Beta; H.K-ATPase, beta subunit; H+,K+-ATPase; H+/K+ ATPase beta; H+/K+ ATPase beta subunit; H+/K+-ATPase beta; H+/K+-ATPase beta subunit; potassium-transporting ATPase beta chain; potassium-transporting ATPase subunit beta; Proton pump beta chain; S76401S1 |
Gene | ATP4B |
Product Type | Antibody |
Gene ID (Entrez) | 100009125, 11945, 24217, 397131, 404020, 496, 614308 |
Formulation | ascites diluted in PBS with 0.05% sodium azide |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 2G11 |
Target Species | Human,Mouse |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Gene Accession No. | Q92581 |
Isotype | IgG |
Antigen | SLC9A6 |
Gene Symbols | SLC9A6 |
Gene Alias | Sodium/hydrogen exchanger 6, Na(+)/H(+) exchanger 6, NHE-6, Solute carrier family 9 member 6, KIAA0267, NHE6 |
Gene | SLC9A6 |
Gene ID (Entrez) | 10479, 236794 |
Formulation | Dulbecco′s PBS with 150mM NaCl, 50% glycerol and 0.02% sodium azide; pH 7.4 |
Immunogen | A synthetic peptide derived from the internal region of human SLC9A6 |
Classification | Polyclonal |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | O14745, P70441 |
Concentration | 1 mg/mL |
Antigen | EBP50 |
Gene Symbols | SLC9A3R1 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | EBP50; EBP-50; ERM-binding phosphoprotein; ezrin-radixin-moesin binding phosphoprotein-50; ezrin-radixin-moesin-binding phosphoprotein 50; Na(+)/H(+) exchange regulatory cofactor NHE-RF1; Na+/H+ exchange regulatory co-factor; Nherf; NHE-RF; Nherf1; NHERF-1; NPHLOP2; Regulatory cofactor of Na(+)/H(+) exchanger; SLC9A3 regulator 1; Slc9a3r1; So; Sodium-hydrogen exchanger regulatory factor 1; solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1; solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatory factor 1; solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1; solute carrier family 9 isoform A3 regulatory factor 1; solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 1 |
Gene | SLC9A3R1 |
Product Type | Antibody |
Gene ID (Entrez) | 26941, 9368 |
Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
Classification | Polyclonal |
Primary or Secondary | Primary |