accessibility menu, dialog, popup

Test

Viewing profile as user:

Antibodies

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (197)
Secondary Antibodies (3)
Isotype Controls and Standards (3)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

hydrogen

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (1)
  • (2)
  • (1)
  • (2)
  • (4)
  • (1)
  • (2)
  • (7)
  • (1)
  • (1)
  • (101)
  • (1)
  • (1)
  • (3)
  • (34)
  • (5)
  • (1)
  • (135)
  • (1)

special interests

  • (2)
  • (56)

Applications

  • (1)
  • (1)
  • (16)
  • (22)
  • (51)
  • (4)
  • (13)
Show all

Classification

  • (37)
  • (145)
  • (2)

Conjugate

  • (2)
  • (1)
  • (2)
  • (2)
  • (2)
  • (1)
  • (2)
Show all

Host Species

  • (1)
  • (1)
  • (32)
  • (150)

Isotype

  • (152)
  • (6)
  • (2)
  • (7)
  • (8)
  • (8)
  • (1)

Quantity

  • (1)
  • (11)
  • (127)
  • (17)
  • (1)
  • (5)
  • (5)
Show all

Regulatory Status

  • (184)

Target Species

  • (11)
  • (9)
  • (7)
  • (1)
  • (7)
  • (174)
  • (12)
Show all

Form

  • (2)
  • (142)
  • (6)
  • (15)
  • (1)
1 – 15 of 194 results
1

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Antigen Hydrogen Potassium ATPase Beta
Gene Symbols ATP4B
Regulatory Status RUO
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Gene ID (Entrez) 496
Immunogen Synthetic peptide directed towards the C terminal of human Atp4b. Peptide sequence QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL.
Classification Polyclonal
Isotype IgG
Gene Accession No. NP_036642
Primary or Secondary Primary
2

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. P51164
Antigen Hydrogen Potassium ATPase Beta
Gene Symbols ATP4B
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
3

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 1 publication

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. P51164
Antigen Hydrogen Potassium ATPase Beta
Gene Symbols ATP4B
Regulatory Status RUO
Molecular Weight of Antigen 33 kDa
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Immunogen Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK.
Classification Polyclonal
Primary or Secondary Primary
Test Specificity This product is specific to Subunit or Isoform: beta.
4

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. P51164
Antigen Hydrogen Potassium ATPase Beta
Gene Symbols ATP4B
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFP
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
5

Hydrogen Potassium ATPase Beta Antibody (2G11), Novus Biologicals™
SDP

Mouse Monoclonal Antibody has been used in 5 publications

Content And Storage Store at -20°C. Avoid freeze/thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot
Form Ascites
Isotype IgG1
Antigen Hydrogen Potassium ATPase Beta
Gene Symbols ATP4B
Regulatory Status RUO
Purification Method Unpurified
Dilution Western Blot 1:4000, Flow Cytometry 1:50, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10 - 1:500, Immunohistochemistry-Paraffin 1:2000, Immunohistochemistry-Frozen 1:2000, Dot Blot 1:100 - 1:2000, Chromatin Immunoprecipitation (ChIP) 1:10-1:500
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Immunogen Purified 34 kDa core peptide from deglycosylated hog gastric microsomes.
Classification Monoclonal
Primary or Secondary Primary
Test Specificity Detects the beta-subunit of hydrogen/potassium ATPase.
Clone 2G11
6

Hydrogen Potassium ATPase Beta Antibody (SR1980), Novus Biologicals™
SDP

Rabbit Monoclonal Antibody

Content And Storage Store at -20° C. Avoid freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Research Discipline Endocrinology, Signal Transduction
Antigen Hydrogen Potassium ATPase Beta
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:2000
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Formulation PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Immunogen A synthesized peptide derived from human Hydrogen Potassium ATPase Beta (Uniprot #: P51164)
Classification Monoclonal
Primary or Secondary Primary
Clone SR1980
7

Hydrogen Potassium ATPase Beta Antibody (2G11), Novus Biologicals™
SDP

Mouse Monoclonal Antibody has been used in 5 publications

8

Hydrogen Potassium ATPase Beta Rabbit anti-Human, Mouse, Rat, Clone: 3Y1Y1, Novus Biologicals™
SDP

Rabbit Monoclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Endocrinology, Signal Transduction
Antigen Hydrogen Potassium ATPase Beta
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Immunogen A synthetic peptide corresponding to a sequence within amino acids 192-291 of human Hydrogen Potassium ATPase Beta (P51164).
Classification Monoclonal
Primary or Secondary Primary
Clone 3Y1Y1
10

hydrogen exchanger 3 Rabbit anti-Human, Polyclonal, Bioss
SDP

Rabbit Polyclonal Antibody

ENCOMPASS_PREFERRED
11

Sodium/Hydrogen Exchanger 1 Rabbit anti-Human, Polyclonal, Bioss
SDP

Rabbit Polyclonal Antibody

ENCOMPASS_PREFERRED
12

Sodium/Hydrogen Exchanger 1 Rabbit anti-Human, Mouse, Non-human Primate, Rat, Polyclonal, FabGennix

Rabbit Polyclonal Antibody

ENCOMPASS
13

ATP4B Monoclonal Antibody (2G11), Invitrogen™

Mouse Monoclonal Antibody

EDGE
Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Bovine,Canine,Human,Mouse,Mustelid,Porcine,Rabbit,Rat
Host Species Mouse
Conjugate Unconjugated
Applications ChIP Assay,Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form Liquid
Isotype IgG1
Gene Accession No. P18434, P18597, P18598, P33704, P50992, P51164
Concentration Conc. Not Determined
Antigen ATP4B
Gene Symbols ATP4B
Regulatory Status RUO
Gene Alias (H+,K+)-ATPase beta-subunit; ATP4B; ATP6B; ATPase H+/K+ transporting beta subunit; ATPase H+/K+ transporting subunit beta; ATPase H+K+-transporting beta / (gastric HK-ATPase beta subunit) defined by SSR; ATPase, H+,K+-transporting, beta / (gastric H,K-ATPase beta subunit), defined by SSR; ATPase, H+/K+ exchanging, beta polypeptide; ATPase, H+/K+ transporting, beta polypeptide; ATPase, H+/K+ transporting, beta polypeptide, gastric specific; AV080843; gastric H(+)/K(+) ATPase subunit beta; gastric H+/K+ ATPase beta subunit; gastric H+/K+-ATPase beta subunit; gastric hydrogen-potassium ATPase, beta; gp60-90; H,K-ATPase-Beta; H.K-ATPase, beta subunit; H+,K+-ATPase; H+/K+ ATPase beta; H+/K+ ATPase beta subunit; H+/K+-ATPase beta; H+/K+-ATPase beta subunit; potassium-transporting ATPase beta chain; potassium-transporting ATPase subunit beta; Proton pump beta chain; S76401S1
Gene ATP4B
Product Type Antibody
Gene ID (Entrez) 100009125, 11945, 24217, 397131, 404020, 496, 614308
Formulation ascites diluted in PBS with 0.05% sodium azide
Classification Monoclonal
Primary or Secondary Primary
Clone 2G11
14

SLC9A6 Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Gene Accession No. Q92581
Isotype IgG
Antigen SLC9A6
Gene Symbols SLC9A6
Gene Alias Sodium/hydrogen exchanger 6, Na(+)/H(+) exchanger 6, NHE-6, Solute carrier family 9 member 6, KIAA0267, NHE6
Gene SLC9A6
Gene ID (Entrez) 10479, 236794
Formulation Dulbecco′s PBS with 150mM NaCl, 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen A synthetic peptide derived from the internal region of human SLC9A6
Classification Polyclonal
15

EBP50 Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form Liquid
Isotype IgG
Gene Accession No. O14745, P70441
Concentration 1 mg/mL
Antigen EBP50
Gene Symbols SLC9A3R1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias EBP50; EBP-50; ERM-binding phosphoprotein; ezrin-radixin-moesin binding phosphoprotein-50; ezrin-radixin-moesin-binding phosphoprotein 50; Na(+)/H(+) exchange regulatory cofactor NHE-RF1; Na+/H+ exchange regulatory co-factor; Nherf; NHE-RF; Nherf1; NHERF-1; NPHLOP2; Regulatory cofactor of Na(+)/H(+) exchanger; SLC9A3 regulator 1; Slc9a3r1; So; Sodium-hydrogen exchanger regulatory factor 1; solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1; solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatory factor 1; solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1; solute carrier family 9 isoform A3 regulatory factor 1; solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 1
Gene SLC9A3R1
Product Type Antibody
Gene ID (Entrez) 26941, 9368
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide
Classification Polyclonal
Primary or Secondary Primary