accessibility menu, dialog, popup

Test

Viewing profile as user:

Primary Antibodies

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (121)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

oxygen

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (6)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1)
  • (46)
  • (2)
  • (10)
  • (1)
  • (1)
  • (2)
  • (3)
  • (1)
  • (1)
  • (80)
  • (1)

special interests

  • (29)

Conjugate

  • (4)
  • (1)
  • (4)
  • (5)
  • (2)
  • (79)

Quantity

  • (3)
  • (51)
  • (18)
  • (3)
  • (5)
  • (1)
  • (3)
Show all

Applications

  • (1)
  • (9)
  • (17)
  • (39)
  • (10)
  • (10)
  • (34)
Show all

Classification

  • (36)
  • (54)
  • (4)

Host Species

  • (4)
  • (23)
  • (67)

Isotype

  • (1)
  • (62)
  • (8)
  • (3)
  • (4)
  • (5)
  • (7)
Show all

Regulatory Status

  • (94)

Target Species

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (93)
  • (47)
Show all

Form

  • (81)
  • (1)
  • (5)
1 – 15 of 114 results
1

Oxygen-regulated protein 1 Rabbit anti-Human∣Mouse∣Rat, Polyclonal, Bioss
SDP

Rabbit Polyclonal Antibody

ENCOMPASS_PREFERRED
2

Cathepsin K Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Research Discipline Cancer
Antigen Cathepsin K
Gene Symbols CTSK
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD
Gene ID (Entrez) 1513
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
4

RP1 Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Liquid
Isotype IgG
Gene Accession No. P56715
Concentration 0.3 mg/mL
Antigen RP1
Gene Symbols RP1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias Dcdc3; DCDC4A; mG145; Orp1; oxygen-regulated protein 1; retinitis pigmentosa 1 (autosomal dominant); retinitis pigmentosa 1 (human); retinitis pigmentosa 1 homolog; retinitis pigmentosa 1 protein; Retinitis pigmentosa RP1 protein; retinitis pigmentosa RP1 protein homolog; RP1; Rp1h
Gene RP1
Product Type Antibody
Gene ID (Entrez) 6101
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Classification Polyclonal
Primary or Secondary Primary
5

RP1 Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P56715, P56716
Concentration 2 mg/mL
Antigen RP1
Gene Symbols RP1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias Dcdc3; DCDC4A; mG145; Orp1; oxygen-regulated protein 1; retinitis pigmentosa 1 (autosomal dominant); retinitis pigmentosa 1 (human); retinitis pigmentosa 1 homolog; retinitis pigmentosa 1 protein; Retinitis pigmentosa RP1 protein; retinitis pigmentosa RP1 protein homolog; RP1; Rp1h
Gene RP1
Product Type Antibody
Gene ID (Entrez) 19888, 6101
Formulation PBS with 0.05% sodium azide
Classification Polyclonal
Primary or Secondary Primary
6

ORP150/HSP12A Antibody (6G7-2H5), Novus Biologicals™
SDP

Mouse Monoclonal Antibody

Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry,Immunofluorescence
Form Purified
Isotype IgG2a
Research Discipline Hypoxia
Antigen ORP150/HSP12A
Gene Symbols HYOU1
Regulatory Status RUO
Purification Method Protein G purified
Dilution Western Blot 1:100 - 1:2000, Immunocytochemistry/Immunofluorescence 1:10 - 1:500
Gene Alias 150 kDa oxygen-regulated protein, 170 kDa glucose-regulated protein, DKFZp686N08236, FLJ97572, glucose-regulated protein 170, GRP170, GRP-170, HSP12A, hypoxia up-regulated 1, hypoxia up-regulated protein 1, ORP-150, ORP150FLJ94899, oxygen regulated protein (150kD)
Gene ID (Entrez) 10525
Immunogen Raised against a synthetic peptide of human GRP170
Classification Monoclonal
Primary or Secondary Primary
Test Specificity Detects 170kDa.
Clone 6G7-2H5
7

PLEKHO2 Monoclonal Antibody (3D9), Invitrogen™

Mouse Monoclonal Antibody

Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA,Western Blot
Form Liquid
Isotype IgG1 κ
Gene Accession No. Q8TD55
Antigen PLEKHO2
Gene Symbols PLEKHO2
Regulatory Status RUO
Purification Method Protein A
Gene Alias AI840980; PH domain-containing family O member 2; PH domain-containing family Q member 1; PH domain-containing protein; PH domain-containing protein homolog; pleckstrin homology domain containing O2; pleckstrin homology domain containing, family O member 2; pleckstrin homology domain containing, family Q member 1; pleckstrin homology domain-containing family O member 2; Pleckstrin homology domain-containing family Q member 1; PLEKHO2; Plekhq1; PP1628; pp9099
Gene PLEKHO2
Product Type Antibody
Gene ID (Entrez) 80301
Formulation PBS with no preservative; pH 7.4
Classification Monoclonal
Primary or Secondary Primary
Clone 3D9
8

ORP150/HSP12A Antibody (6E3-2C3), Novus Biologicals™
SDP

Mouse Monoclonal Antibody

Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry,Immunofluorescence
Form Purified
Isotype IgG2b
Research Discipline Hypoxia
Antigen ORP150/HSP12A
Gene Symbols HYOU1
Regulatory Status RUO
Purification Method Protein G purified
Dilution Western Blot 1:100 - 1:2000, Immunocytochemistry/Immunofluorescence 1:10 - 1:500
Gene Alias 150 kDa oxygen-regulated protein, 170 kDa glucose-regulated protein, DKFZp686N08236, FLJ97572, glucose-regulated protein 170, GRP170, GRP-170, HSP12A, hypoxia up-regulated 1, hypoxia up-regulated protein 1, ORP-150, ORP150FLJ94899, oxygen regulated protein (150kD)
Gene ID (Entrez) 10525
Immunogen Recombinant Full length GRP170 Protein
Classification Monoclonal
Primary or Secondary Primary
Test Specificity Detects 170 kDa.
Clone 6E3-2C3
9

NDRG1 Mouse anti-Human, Clone: 11G4, Novus Biologicals™
SDP

Mouse Monoclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Flow Cytometry,ELISA,Immunocytochemistry,Immunofluorescence
Form Purified
Isotype IgG1 κ
Research Discipline Cancer
Concentration 1 mg/mL
Antigen NDRG1
Gene Symbols NDRG1
Regulatory Status RUO
Purification Method Protein A purified
Dilution Western Blot 1:1000, Flow Cytometry 1:10-1:1025, ELISA, Immunocytochemistry/Immunofluorescence 1:100
Gene Alias CAP43, CMT4D, Differentiation-related gene 1 protein, DRG-1, DRG1HMSNL, NDR1, Nickel-specific induction protein Cap43, NMSL, N-myc downstream regulated 1, N-myc downstream-regulated gene 1 protein, protein NDRG1, protein regulated by oxygen-1, PROXY1, Reducing agents and tunicamycin-responsive protein, RIT42, RTPGC4, TARG1, TDD5, tunicamycin-responsive protein
Gene ID (Entrez) 10397
Formulation Liquid. In PBS (pH 7.4), 10% Glycerol with 0.02% Sodium Azide
Immunogen Recombinant human NDRG1 (1-394aa) purified from E. coli
Classification Monoclonal
Primary or Secondary Primary
Clone 11G4
10

PLEKHO2 Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry
Form Liquid
Isotype IgG
Gene Accession No. Q8TD55
Concentration 0.2 mg/mL
Antigen PLEKHO2
Gene Symbols PLEKHO2
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias AI840980; PH domain-containing family O member 2; PH domain-containing family Q member 1; PH domain-containing protein; PH domain-containing protein homolog; pleckstrin homology domain containing O2; pleckstrin homology domain containing, family O member 2; pleckstrin homology domain containing, family Q member 1; pleckstrin homology domain-containing family O member 2; Pleckstrin homology domain-containing family Q member 1; PLEKHO2; Plekhq1; PP1628; pp9099
Gene PLEKHO2
Product Type Antibody
Gene ID (Entrez) 80301
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Classification Polyclonal
Primary or Secondary Primary
11

RSAD1 Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Liquid
Isotype IgG
Gene Accession No. Q9HA92
Concentration 0.3 mg/mL
Antigen RSAD1
Gene Symbols RSAD1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias B430319G23; BC056485; oxygen-independent coproporphyrinogen-III oxidase-like protein RSAD1; Putative heme chaperone; radical S-adenosyl methionine domain containing 1; radical S-adenosyl methionine domain-containing protein 1, mitochondrial; RSAD1
Gene RSAD1
Product Type Antibody
Gene ID (Entrez) 55316
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Classification Polyclonal
Primary or Secondary Primary
12

Cathepsin K Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_000387
Research Discipline Cancer
Antigen Cathepsin K
Gene Symbols CTSK
Regulatory Status RUO
Molecular Weight of Antigen 37 kDa
Gene Alias cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD
Gene ID (Entrez) 1513
Immunogen Synthetic peptide directed towards the middle region of human CTSK. Peptide sequence SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY.
Classification Polyclonal
Primary or Secondary Primary
13

RSAD1 Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG
Gene Accession No. Q9HA92
Concentration 0.5 mg/mL
Antigen RSAD1
Gene Symbols RSAD1
Regulatory Status RUO
Purification Method Antigen affinity chromatography, Protein A
Gene Alias B430319G23; BC056485; oxygen-independent coproporphyrinogen-III oxidase-like protein RSAD1; Putative heme chaperone; radical S-adenosyl methionine domain containing 1; radical S-adenosyl methionine domain-containing protein 1, mitochondrial; RSAD1
Gene RSAD1
Product Type Antibody
Gene ID (Entrez) 55316
Formulation PBS with 0.09% sodium azide
Classification Polyclonal
Primary or Secondary Primary
14

C17orf62 Monoclonal Antibody (OTI2B8), Invitrogen™

Mouse Monoclonal Antibody

Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunocytochemistry,Western Blot
Form Liquid
Isotype IgG1
Gene Accession No. Q9BQA9
Concentration 1 mg/mL
Antigen C17orf62
Gene Symbols C17ORF62
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias C17orf62; chromosome 17 open reading frame 62; CYBC1; Cytochrome b-245 chaperone 1; EROS; Essential for reactive oxygen species protein; HAPSTR1; uncharacterized protein C17orf62
Gene C17ORF62
Product Type Antibody
Gene ID (Entrez) 79415
Formulation PBS with 1% BSA, 50% glycerol and 0.02% sodium azide; pH 7.3
Classification Monoclonal
Primary or Secondary Primary
Clone OTI2B8
15

C17orf62 Monoclonal Antibody (OTI3F10), Invitrogen™

Mouse Monoclonal Antibody

Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunocytochemistry,Western Blot
Form Liquid
Isotype IgG1
Gene Accession No. Q9BQA9
Concentration 1 mg/mL
Antigen C17orf62
Gene Symbols C17ORF62
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias C17orf62; chromosome 17 open reading frame 62; CYBC1; Cytochrome b-245 chaperone 1; EROS; Essential for reactive oxygen species protein; HAPSTR1; uncharacterized protein C17orf62
Gene C17ORF62
Product Type Antibody
Gene ID (Entrez) 79415
Formulation PBS with 1% BSA, 50% glycerol and 0.02% sodium azide; pH 7.3
Classification Monoclonal
Primary or Secondary Primary
Clone OTI3F10