accessibility menu, dialog, popup

Test

Viewing profile as user:

Primary Antibodies

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (520)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

dopamine

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (6)
  • (16)
  • (7)
  • (6)
  • (9)
  • (1)
  • (4)
  • (10)
  • (120)
  • (42)
  • (181)
  • (5)
  • (43)
  • (2)
  • (2)
  • (176)

special interests

  • (1)
  • (201)

Classification

  • (210)
  • (278)
  • (9)
  • (1)

Host Species

  • (14)
  • (1)
  • (190)
  • (276)
  • (6)
  • (11)

Quantity

  • (4)
  • (2)
  • (1)
  • (128)
  • (1)
  • (2)
  • (174)
Show all

Conjugate

  • (1)
  • (2)
  • (4)
  • (5)
  • (5)
  • (4)
  • (4)
Show all

Target Species

  • (1)
  • (16)
  • (25)
  • (14)
  • (25)
  • (1)
  • (4)
Show all

Applications

  • (51)
  • (1)
  • (52)
  • (95)
  • (2)
  • (2)
  • (6)
Show all

Isotype

  • (268)
  • (27)
  • (31)
  • (16)
  • (79)
  • (1)
  • (7)
Show all

Regulatory Status

  • (458)

Form

  • (1)
  • (224)
  • (16)
  • (157)
  • (1)
  • (3)
  • (2)
Show all

Research Discipline

  • (5)
1 – 15 of 500 results
1

Dopamine beta Hydroxylase Polyclonal Antibody, Invitrogen™

Sheep Polyclonal Antibody

EDGE
Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Bovine,Human,Mouse,Rat
Host Species Sheep
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Frozen),Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P09172, P15101, Q05754, Q64237
Concentration Conc. Not Determined
Antigen Dopamine beta Hydroxylase
Gene Symbols DBH
Regulatory Status RUO
Gene Alias Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase
Gene DBH
Product Type Antibody
Gene ID (Entrez) 13166, 1621, 25699, 280758
Formulation whole serum with 0.05% sodium azide
Classification Polyclonal
Primary or Secondary Primary
2

Dopamine beta-Hydroxylase Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Cancer, Lipid and Metabolism, Neuroscience
Antigen Dopamine beta-Hydroxylase
Gene Symbols DBH
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias DBM, dopamine beta-hydroxylase, dopamine beta-hydroxylase (dopamine beta-monooxygenase), Dopamine beta-monooxygenase, EC 1.14.17.1
Gene ID (Entrez) 1621
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
3

MilliporeSigma™ anti-Dopamine D2S Receptor, Polyclonal

Rabbit Polyclonal Antibody

Antigen Dopamine D2S Receptor
Regulatory Status RUO
Content And Storage 2°C to 8°C
Host Species Rabbit
Applications ELISA,Immunoblot,Immunoblot,Immunohistochemistry
Form Undiluted
Formulation Undiluted serum.
Immunogen a synthetic (PLKEAARRC) peptide corresponding to amino acids 239-246 of human D2s dopamine receptor
Classification Polyclonal
Isotype IgG
Primary or Secondary Primary
Test Specificity Recognizes the ∽48kDa dopamine D25 receptor. Does not cross-react with other dopamine receptors.
4

MilliporeSigma™ anti-Dopamine D5 Receptor, Polyclonal

Rabbit Polyclonal Antibody

Antigen Dopamine D5 Receptor
Regulatory Status RUO
Content And Storage 2°C to 8°C
Host Species Rabbit
Applications ELISA,Flow Cytometry,Immunoblot,Immunoblot,Immunohistochemistry
Form Undiluted
Formulation Undiluted serum.
Immunogen a synthetic peptide (LPPGSNGTAYC) corresponding to amino acids 2-10 of human dopamine D5 receptor,conjugated to carrier protein
Classification Polyclonal
Isotype IgG
Primary or Secondary Primary
Test Specificity Recognizes the dopamine D5 receptor in rat brain. Does not cross-react with other dopamine receptors.
5

MilliporeSigma™ anti-Dopamine D2 Receptor, Polyclonal

Rabbit Polyclonal Antibody

Antigen Dopamine D2 Receptor
Regulatory Status RUO
Content And Storage 2°C to 8°C
Host Species Rabbit
Applications ELISA,Immunoblot,Immunoblot,Immunohistochemistry
Form Undiluted
Formulation Undiluted serum.
Immunogen a synthetic peptide (CAARRAQELEME) corresponding to amino acids 272-282 of human D2 dopamine receptor
Classification Polyclonal
Isotype IgG
Primary or Secondary Primary
Test Specificity Recognizes the dopamine D2 receptor in rat brain. Does not cross-react with other dopamine receptors and exhibits minimal cross-reactivity with the D2S short receptor.
6

MilliporeSigma™ anti-Dopamine D3 Receptor, Polyclonal

Rabbit Polyclonal Antibody

Antigen Dopamine D3 Receptor
Regulatory Status RUO
Content And Storage 2°C to 8°C
Host Species Rabbit
Applications ELISA,Flow Cytometry,Immunoblot,Immunoblot,Immunohistochemistry
Form Undiluted
Formulation Undiluted serum.
Immunogen a synthetic peptide (ASLSQLSSHC) corresponding to amino acids (2-10) of human dopamine D3 receptor
Classification Polyclonal
Isotype IgG
Primary or Secondary Primary
Test Specificity Recognizes the dopamine D3 receptor in rat brain. Does not cross-react with other dopamine receptors.
7

MilliporeSigma™ anti-Dopamine D1 Receptor, Polyclonal

Rabbit Polyclonal Antibody

Antigen Dopamine D1 Receptor
Regulatory Status RUO
Content And Storage 2°C to 8°C
Host Species Rabbit
Applications ELISA,Immunoblot,Immunoblot,Immunohistochemistry (Frozen)
Form Undiluted
Formulation Undiluted serum.
Immunogen a synthetic peptide (MDGTGLVVERDFSC) corresponding to amino acids 9-21 of human D1,subscript_end;dopamine receptor
Classification Polyclonal
Isotype IgG
Primary or Secondary Primary
Test Specificity Recognizes the dopamine D1 receptor in rat brain. Does not cross-react with other dopamine receptors.
8

MilliporeSigma™ anti-Dopamine D4 Receptor, Polyclonal

Rabbit Polyclonal Antibody

Antigen Dopamine D4 Receptor
Regulatory Status RUO
Content And Storage 2°C to 8°C
Host Species Rabbit
Applications ELISA,Immunoblot,Immunoblot,Immunohistochemistry
Form Undiluted
Formulation Undiluted serum.
Immunogen a synthetic peptide corresponding to amino acids 176-185 of human dopamine D4 receptor
Classification Polyclonal
Isotype IgG
Primary or Secondary Primary
Test Specificity Recognizes the ∽48-51kDa dopamine D4 receptor in rat brain. Does not cross-react with other dopamine receptors.
9

Dopamine D3R/DRD3 Antibody (SR1747), Novus Biologicals™
SDP

Rabbit Monoclonal Antibody

Content And Storage Store at -20° C. Avoid freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Research Discipline GPCR
Antigen Dopamine D3R/DRD3
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:2000
Gene Alias D(3) dopamine receptor, D3DR, Dopamine D3 receptor, dopamine receptor D3, essential tremor 1, ETM1, FET1, MGC149204, MGC149205
Gene ID (Entrez) 1814
Formulation PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Immunogen A synthesized peptide derived from human Dopamine D3R/DRD3 (Uniprot #: P35462)
Classification Monoclonal
Primary or Secondary Primary
Clone SR1747
10

Dopamine Receptor D4 Antibody - BSA Free, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Research Discipline GPCR, Neuroscience
Antigen Dopamine Receptor D4
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:1000
Gene Alias D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor
Gene ID (Entrez) 1815
Formulation PBS with 50% glycerol, pH7.3.
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Receptor D4 (P21917). MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGA
Classification Polyclonal
Primary or Secondary Primary
11

Dopamine Transporter Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Mouse,Rat,Zebrafish
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P23977, Q61327
Concentration 0.94 mg/mL
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 13162, 24898, 80787
Formulation PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Classification Polyclonal
Primary or Secondary Primary
12

Dopamine Transporter Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P23977, Q01959, Q61327
Concentration 3.92 mg/mL
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 13162, 24898, 6531
Formulation PBS with 50% glycerol and 0.01% thimerosal; pH 7.3
Classification Polyclonal
Primary or Secondary Primary
13

Dopamine Transporter Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P23977, Q01959, Q61327
Concentration 1 mg/mL
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 13162, 24898, 6531
Formulation PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Classification Polyclonal
Primary or Secondary Primary
14

Dopamine Transporter Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Liquid
Isotype IgG
Gene Accession No. Q01959
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 6531
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Classification Polyclonal
Primary or Secondary Primary
15

Dopamine Transporter Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Non-human Primate,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P23977, Q01959, Q61327
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 13162, 24898, 6531
Formulation 0.01M HEPES with 0.15M NaCl, 100μg/mL BSA, 50% glycerol and no preservative; pH 7.5
Classification Polyclonal
Primary or Secondary Primary