Novus Biologicals

Browse a range of Novus Biologicals antibodies, proteins, stains, kits, research reagents, and other products to support your scientific needs.

Narrow Results

special interests

Small and Specialty Supplier (765,757)

Classification

Monoclonal (367,377)
Polyclonal (326,078)

Regulatory Status

RUO (621,993)

1 – 15 of 718,903 results

Collagen I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 195 publications

Pricing & Availability

SCF/c-kit Ligand Rabbit anti-Human, Clone: 4, Novus Biologicals™

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA
Form	Purified
Isotype	IgG
Research Discipline	Biologically Active Proteins, Cancer, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Stem Cell Markers
Antigen	SCF/c-kit Ligand
Regulatory Status	RUO
Purification Method	Protein A purified
Dilution	ELISA 1:5000-1:10000, Sandwich ELISA Detection 1:1000-1:10000
Gene Alias	DKFZp686F2250, familial progressive hyperpigmentation 2, FPH2, KIT ligand, Kitl, KL-1, Mast cell growth factor, MGFSHEP7, SCFStem cell factor, SFc-Kit ligand, steel factor
Gene ID (Entrez)	4254
Formulation	0.2 um filtered solution in PBS
Immunogen	Recombinant Human SCF/c-kit Ligand protein
Classification	Monoclonal
Primary or Secondary	Primary
Clone	4

Novus Biologicals™ LPS from E. Coli, TLR4 ligand

Applications: Functional

Pricing & Availability

CD90/Thy1 Antibody (783922), PE, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability

Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Peptide Array
Form	Purified
Isotype	IgG2c κ
Research Discipline	Cancer
Concentration	0.2 mg/mL
Antigen	Kallikrein 5
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Immunohistochemistry-Paraffin 1 to 2 μg/mL, Protein Array
Gene Alias	EC 3.4.21, EC 3.4.21.4, kallikrein 5, Kallikrein-like protein 2, kallikrein-related peptidase 5, KLKL2, KLK-L2EC 3.4.21.-, SCTEkallikrein-5, Stratum corneum tryptic enzyme
Gene ID (Entrez)	25818
Formulation	10 mM PBS with 0.05% BSA
Immunogen	Recombinant fragment of human Kallikrein 5 protein (around aa 36-177) (exact sequence is proprietary)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	KLK5/3841

Content And Storage	Store at 4°C in the dark. Do not freeze.

MARCO Antibody (579511), PE/Cy7, Novus Biologicals™

Rat Monoclonal Antibody

Pricing & Availability

GABA Transporter 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Pricing & Availability

Novus Biologicals™ Granulin Antibody Pair [HRP]

Antibody Pair

Pricing & Availability
Specifications

Immunoassay Kit Format	Sandwich ELISA Kit
Target Species	Mouse
Conjugate	HRP
Gene Symbol	GRN
Assay Sensitivity	39.06 pg/mL (example only; lot dependent)
Storage Requirements	Storage of components varies. See protocol for specific instructions.
Research Discipline	Cell Cycle and Replication
Assay Range	39.06 to 2500 pg/mL (example only, lot dependent)
For Use With (Application)	ELISA, Sandwich ELISA
Detection Method	Sandwich ELISA
Target	Mouse
Specificity	This solid phase sandwich ELISA utilizes a monoclonal antibody specific for Mouse Granulin.
Product Type	Sandwich ELISA
Gene ID (Entrez)	2896
Synonym	acrogranin, GEP, GP88, granulin, granulin-epithelin, granulins, PC cell-derived growth factor, PCDGF, PEPI, PGRN, proepithelin, progranulin

Calretinin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunohistochemistry,Immunocytochemistry,Immunohistochemistry (Paraffin),Immunohistochemistry (Free Floating),KnockDown
Form	Purified
Isotype	IgG
Research Discipline	Cellular Markers
Antigen	Calretinin
Regulatory Status	RUO
Purification Method	Immunogen affinity purified
Dilution	Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunohistochemistry Free-Floating, Knockdown Validated
Gene Alias	29 kDa calbindin, CAB29, CAL2, calbindin 2, calbindin 2, (29kD, calretinin), calbindin 2, 29kDa (calretinin), calbindin D29K, calretinin, CR
Gene ID (Entrez)	794
Formulation	PBS (pH 7.2) and 40% Glycerol
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals™ Copper Assay Kit (Colorimetric)

Assay Kit (Colorimetric)

Pricing & Availability

alpha-Synuclein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Pricing & Availability

Novus Biologicals™ Transglutaminase 2/TGM2 Assay Kit (Colorimetric)

Applications: Functional

Pricing & Availability

Novus Biologicals™ Fibroblast Activation Protein alpha/FAP Antibody (sibrotuzumab) - Humanized, Novus Biologicals™

Human Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at -20°C in powder form. Store at -80°C once reconstituted.
Target Species	Human
Host Species	Human
Conjugate	Unconjugated
Applications	Flow Cytometry,ELISA,Functional Assay
Form	Purified
Isotype	IgG1
Gene Accession No.	Q12884
Research Discipline	Cancer, Protein Phosphatase
Antigen	Fibroblast Activation Protein alpha/FAP
Regulatory Status	RUO
Purification Method	Protein A purified
Gene Alias	170 kDa melanoma membrane-bound gelatinase, DKFZp686G13158, DPPIV, EC 3.4.21.-, FAPA, Fibroblast activation protein alpha, fibroblast activation protein, alpha, Integral membrane serine protease, seprase, vibronectin
Gene ID (Entrez)	2191
Formulation	Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2)
Immunogen	FAP
Classification	Monoclonal
Reconstitution	Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex.
Primary or Secondary	Primary
Clone	sibrotuzumab

Cytokeratin, pan Antibody (AE-1/AE-3), Alexa Fluor™ 647, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 2 publications

Pricing & Availability
Specifications

Content And Storage	Store at 4C in the dark.
Conjugate	Alexa Fluor 647
Target Species	Human,Mouse,Rat,Bovine,Canine,Chicken,Primate,Rabbit,Reptile,Zebrafish
Host Species	Mouse
Applications	Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen)
Form	Purified
Isotype	IgG1 κ,IgG1 κ
Antigen	pan Cytokeratin
Regulatory Status	RUO
Purification Method	Protein A or G purified
Gene ID (Entrez)	3848
Classification	Monoclonal
Immunogen	This Cytokeratin, pan Antibody (AE-1/AE-3) was developed against total keratin isolated from human epidermal callus was used as immunogen to generate the pan cytokeratin antibodies AE1 + AE3 (Woodcock-Mitchell, 1982).
Primary or Secondary	Primary
Clone	AE-1/AE-3

Prev
1
2
3
4
5
6
...
47,927
Next

Novus Biologicals

Filtered Search Results

Narrow Results

Collagen I Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

SCF/c-kit Ligand Rabbit anti-Human, Clone: 4, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ LPS from E. Coli, TLR4 ligand Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

CD90/Thy1 Antibody (783922), PE, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ DRAQ5™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

MARCO Antibody (579511), PE/Cy7, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

GABA Transporter 2 Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Granulin Antibody Pair [HRP] Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Calretinin Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Copper Assay Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

alpha-Synuclein Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Transglutaminase 2/TGM2 Assay Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Fibroblast Activation Protein alpha/FAP Antibody (sibrotuzumab) - Humanized, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Cytokeratin, pan Antibody (AE-1/AE-3), Alexa Fluor™ 647, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More