Invitrogen™ Human KV1.7 (KCNA7) (aa 405-437) Control Fragment Recombinant Protein

Recombinant Protein

Supplier:  Invitrogen™ RP110228

Catalog No. RP110228

Description

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability.

Specifications

• Accession Number: Q96RP8
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 3743
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: KCNA7
• Recombinant: Recombinant
• Expression System: E. coli

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: KV1.7 (KCNA7)
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: HAK6; Kcna7; Kcnc7; Kv1.7; potassium channel, voltage gated shaker related subfamily A, member 7; potassium voltage gated channel, shaker related subfamily, member 7; potassium voltage-gated channel subfamily A member 7; potassium voltage-gated channel, shaker-related subfamily, member 7; potassium voltage-gated channel, shaker-related subfamily, member 7; potassium voltage gated channel, shaker related subfamily, member 7; voltage-dependent potassium channel Kv1.7; voltage-gated potassium channel KCNA7; voltage-gated potassium channel subunit Kv1.7
• Conjugate: Unconjugated
• Sequence: TEGEEAGMFSHVDMQPCGPLEGKANGGLVDGEV