Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ Human KCTD9 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP106158
Description
Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of target proteins, leading to their degradation by the proteasome.Specifications
Q7L273 | |
Blocking Assay, Control | |
54793 | |
100 μL | |
RUO | |
Kctd9 | |
Human | |
NCDLCGCDLQEANLRGSNMKGAIFEEMLTPLYMSQSV | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
KCTD9 | |
-20° C, Avoid Freeze/Thaw Cycles | |
BTB/POZ domain-containing protein KCTD9; BTBD27; KCTD9; potassium channel tetramerisation domain containing 9; potassium channel tetramerization domain containing 9 | |
Unconjugated | |
Recombinant | |
E. coli |
Product Content Correction
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction