Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ Human KCTD18 (aa 99-175) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP106812
Description
KCTD18 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include protein homooligomerization.Specifications
Q6PI47 | |
Blocking Assay, Control | |
130535 | |
100 μL | |
RUO | |
KCTD18 | |
Human | |
YPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGVYATKTDGTDAIEK | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
KCTD18 | |
-20° C, Avoid Freeze/Thaw Cycles | |
4932411A20Rik; 6530404F10Rik; BTB/POZ domain-containing protein KCTD18; KCTD18; potassium channel tetramerisation domain containing 18; potassium channel tetramerization domain containing 18; RGD1564820; similar to potassium channel tetramerisation domain containing 18 | |
Unconjugated | |
Recombinant | |
E. coli |
Product Content Correction
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction