Invitrogen™ Human KCTD16 (aa 324-390) Control Fragment Recombinant Protein

Recombinant Protein

Supplier:  Invitrogen™ RP96971

Catalog No. RP96971

Description

The BTB (Broad-Complex, Tramtrack and Bric a brac) domain, also known as the POZ (Poxvirus and Zinc finger) domain, is an N-terminal homodimerization domain that contains multiple copies of kelch repeats and/or C2H2-type zinc fingers. Proteins that contain BTB domains are thought to be involved in transcriptional regulation via control of chromatin structure and function. KCTD16 (potassium channel tetramerisation domain containing 16), also known as BTB/POZ domain-containing protein KCTD16, is a 428 amino acid protein that contains one BTB (POZ) domain. An auxiliary subunit of GABAB R1 and GABAB R2, KCTD16 increases agonist potency and alters the G-protein signaling of the receptors by accelerating onset and promoting desensitization.

Specifications

• Accession Number: Q68DU8
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 57528
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: KCTD16
• Species: Human
• Sequence: PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: KCTD16
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: 4930434H12Rik; BTB/POZ domain-containing protein KCTD16; Gm1267; KCTD16; KIAA1317; potassium channel tetramerisation domain containing 16; potassium channel tetramerization domain containing 16; potassium channel tetramerization domain-containing protein 16
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli