Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ Human KCTD16 (aa 324-390) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP96971
Description
The BTB (Broad-Complex, Tramtrack and Bric a brac) domain, also known as the POZ (Poxvirus and Zinc finger) domain, is an N-terminal homodimerization domain that contains multiple copies of kelch repeats and/or C2H2-type zinc fingers. Proteins that contain BTB domains are thought to be involved in transcriptional regulation via control of chromatin structure and function. KCTD16 (potassium channel tetramerisation domain containing 16), also known as BTB/POZ domain-containing protein KCTD16, is a 428 amino acid protein that contains one BTB (POZ) domain. An auxiliary subunit of GABAB R1 and GABAB R2, KCTD16 increases agonist potency and alters the G-protein signaling of the receptors by accelerating onset and promoting desensitization.Specifications
Q68DU8 | |
Blocking Assay, Control | |
57528 | |
100 μL | |
RUO | |
KCTD16 | |
Human | |
PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
KCTD16 | |
-20° C, Avoid Freeze/Thaw Cycles | |
4930434H12Rik; BTB/POZ domain-containing protein KCTD16; Gm1267; KCTD16; KIAA1317; potassium channel tetramerisation domain containing 16; potassium channel tetramerization domain containing 16; potassium channel tetramerization domain-containing protein 16 | |
Unconjugated | |
Recombinant | |
E. coli |
Product Content Correction
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction