Invitrogen™ Human Dopamine Transporter (aa 164-234) Control Fragment Recombinant Protein

Recombinant Protein

Supplier:  Invitrogen™ RP90672

Catalog No. RP90672

Description

The Dopamine Transporter (DAT) is responsible for the reaccumulation of dopamine after it has been released. DAT antibodies and antibodies for other markers of catecholamine biosynthesis are widely used as markers for dopaminergic and noradrenergic neurons in a variety of applications including depression, schizophrenia, Parkinson's disease and drug abuse.

Specifications

• Accession Number: Q01959
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 6531
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: Slc6a3
• Species: Human
• Sequence: LHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLG
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: Dopamine Transporter
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli