Invitrogen™ Human Dopamine beta Hydroxylase (aa 136-257) Control Fragment Recombinant Protein

Recombinant Protein

Supplier:  Invitrogen™ RP100516

Catalog No. RP100516

Description

The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide.

Specifications

• Accession Number: P09172
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 1621
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: DBH
• Species: Human
• Sequence: VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: Dopamine beta Hydroxylase
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli