transforming growth factor, beta receptor 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TGFBR1.

Supplier:  Abnova Corporation H00007046A01

Catalog No. 89-004-339

Description

The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: GATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE

Specifications

• Antigen: transforming growth factor, beta receptor 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TGFBR1.
• Gene: TGFBR1
• Gene Alias: AAT5/ACVRLK4/ALK-5/ALK5/LDS1A/LDS2A/SKR4/TGFR-1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004612
• Gene Symbols: TGFBR1
• Immunogen: TGFBR1 (NP_004603, 30 a.a. ∼ 125 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7046
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.